DPCfam | MC53429
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Residues in low-complexity regions (%) | 13.26 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 8.88 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF03170 |
| Sequences matching dominant architecture (%) | 93.8 |
| Average overlap percent | 3.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FD5BCD | 1372-1485 | 114 | LGAIMGFKSPLDGDRSVVVIASSTPGGLVHMSDVLSDPGKSQYVRDELVLVSGDVVNHYDLGSRYAMGKLPFILGMRWWLSHQPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GYM8-F1 | 662-776 | 98.29 | 91.00 | View in AlphaFoldDB ↗ |