DPCfam | MC53157
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 381 ± 37 aa |
| Residues in low-complexity regions (%) | 7.66 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 2.51 |
| Average transmembrane regions | 8.42 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B9PQP2 | 17-436 | 420 | LVEMYLIFTVLLLFFGPLDWNISNSIKLSSYLFMYHFSFVFGYVFFLYKKKDQNKPKSTFYVDGFIIDNYKYILIFSFLGSVISY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PZS9-F1 | 107-228 | 29.95 | 89.56 | View in AlphaFoldDB ↗ |