DPCfam | MC53149
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.51 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF09904 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 95.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005F7C754 | 15-88 | 74 | ARDDNRKLALLVAINRIPKPKESDIIAATGLPKRCIYAMIDALGKMNVVIERANGRRYGYFKIADGGVYDLERA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I286-F1 | 5-90 | 98.81 | 93.94 | View in AlphaFoldDB ↗ |