DPCfam | MC52967
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 228 ± 38 aa |
| Residues in low-complexity regions (%) | 3.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.75 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A32061C | 617-836 | 220 | ANLHPAKPKDFSAFINLVEFCREILPKKQIRYFEPWVYSFGYELILQSTRLPLISGFYKLLSIAVRNARKIKYFEGVSPKSPKHS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O43592-F1 | 375-525 | 52.17 | 91.03 | View in AlphaFoldDB ↗ |