DPCfam | MC5283
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 467 ± 72 aa |
| Residues in low-complexity regions (%) | 1.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09737 |
| Sequences matching dominant architecture (%) | 85.25 |
| Average overlap percent | 75.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D8XPB6 | 50-489 | 440 | YSRNGGSTVCVRHVRNQREFYSAVAMDRIVEVSERHHMQDHVISWTPDGKRLITFRMHLRAVRILRYLGVESARDSNPENLCQRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7L5Y6-F1 | 33-536 | 99.80 | 89.64 | View in AlphaFoldDB ↗ |