DPCfam | MC5275
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Residues in low-complexity regions (%) | 5.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.56 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF06414 |
| Sequences matching dominant architecture (%) | 2.17 |
| Average overlap percent | 1.08 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L1IPV0 | 6-87 | 82 | VRVWLQDHYYTFSRFLVSRVLTVTQVSYADSLKISLAVKKVLVDRGTFDVTQEQMEEALFNIMRLHGYGDEHICRYRLMTKF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0PDN9-F1 | 39-129 | 100.00 | 93.00 | View in AlphaFoldDB ↗ |