DPCfam | MC52579
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Residues in low-complexity regions (%) | 1.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.83 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01190 |
| Sequences matching dominant architecture (%) | 97.67 |
| Average overlap percent | 68.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0SXL8 | 8-151 | 144 | RSMLLGLCAVLLMLRFSRAATQTETSVTVVGATECLDCERKSIKHENAVKGLRVAIKCRDGNEKYEIKATGDLDSNGSFNVKLPT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O49813-F1 | 24-144 | 94.49 | 94.77 | View in AlphaFoldDB ↗ |