DPCfam | MC52321
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 269 ± 17 aa |
| Residues in low-complexity regions (%) | 12.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.88 |
| Average transmembrane regions | 5.24 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4WVD1 | 285-563 | 278 | WFAWPALPLVLWTLWTRGRGFNGGLATPGVQLLGMLSLVIAISMLAKTEPRAIELMPMLVPLSLLGALEVDTLKRGFSGALDWFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F511-F1 | 276-547 | 99.64 | 93.56 | View in AlphaFoldDB ↗ |