DPCfam | MC52249
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 246 ± 33 aa |
| Residues in low-complexity regions (%) | 2.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.31 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A175VV44 | 30-298 | 269 | PGCRTQSSYNPIVEDYPLNITGMANGTFASIFVVREIAESLLPEGLGFLDEAYHREYELYRDNYIPLLVRALYVHDIRAPDDMWR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VW07-F1 | 76-331 | 99.22 | 95.39 | View in AlphaFoldDB ↗ |