DPCfam | MC52114
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Residues in low-complexity regions (%) | 8.67 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 0.37 |
| Average transmembrane regions | 2.19 |
| Dominant Pfam architecture(s) | PF18902 |
| Sequences matching dominant architecture (%) | 99.03 |
| Average overlap percent | 88.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q3W4J8 | 12-103 | 92 | SIYLLVLAILDSIFTDYGIRNKHISEANPLMKLLYDTSIVGIVGFYFIKISLPLLLIYIMTKVQPKRYIQLLLVVALLIYSGVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O28934-F1 | 44-116 | 80.43 | 84.80 | View in AlphaFoldDB ↗ |