DPCfam | MC52098
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 1.75 |
| Average overlap percent | 2.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U6G963 | 2419-2527 | 109 | FTWKTCRSLLLQLQQPAESFSIDGELYRHWQLSLVPTRMYRGRLKSGRGVFVKQVPASVWRYQWKQQQRFQGQFICDGENYVGEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9ZSH8-F1 | 192-354 | 99.28 | 77.75 | View in AlphaFoldDB ↗ |