DPCfam | MC52037
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.12 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09709 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 23.01 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002FAF0D8 | 1-115 | 115 | MILQKLCEYYDAHQKELPDYGFEIESISFCLVIDKEGYLVEVEDIREHTEKKPRSIRMMVPGHSKKRTSGIRPHLLWDNVKYVLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F7Z9-F1 | 1-138 | 100.00 | 94.84 | View in AlphaFoldDB ↗ |