DPCfam | MC51944
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1221 |
|---|---|
| Mean domain length (aa) | 281 ± 35 aa |
| Residues in low-complexity regions (%) | 3.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02626 |
| Sequences matching dominant architecture (%) | 97.77 |
| Average overlap percent | 90.99 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A04E64F | 13-306 | 294 | VTQPGLLATLQDFGRYGYQALGITHGGPMDERAFLWANRLLGNTYDCAQIEITLGHFKATFTRDCLFVVTGADFPLTLAGQPIKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P75745-F1 | 6-288 | 99.63 | 97.12 | View in AlphaFoldDB ↗ |