DPCfam | MC51930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 164 ± 15 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.86 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08013 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 53.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090T658 | 151-317 | 167 | IYEAHSTDYQTAKHLKELVQTHFSILKVGPALTFALREALFALAEIETCLVKSEHNSQFKKVVDDVLLDTPKYWKSYYGEKHSDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8AQ21-F1 | 255-424 | 99.42 | 96.84 | View in AlphaFoldDB ↗ |