DPCfam | MC51847
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 93 ± 18 aa |
| Residues in low-complexity regions (%) | 14.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15151 |
| Sequences matching dominant architecture (%) | 90.32 |
| Average overlap percent | 91.21 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004F4D90E | 73-138 | 66 | SVVGEWKGADSLYRNSFSLSDEKLNSPTASTPSLPSPSVTPCKAKLGDTKELEDFIADLDRTLASM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8WHV1-F1 | 18-126 | 97.14 | 73.48 | View in AlphaFoldDB ↗ |