DPCfam | MC51756
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 112 ± 23 aa |
| Residues in low-complexity regions (%) | 8.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 72.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14604 |
| Sequences matching dominant architecture (%) | 82.76 |
| Average overlap percent | 21.52 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1P6S5 | 493-630 | 138 | TEATQAVDGDRSQLEEAEAVAPLEKVIPSVVIEPASNNEGEGDHEAPAGAESMETPAAAAPGPTTELPELAPEPKAGEDSQPLPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P50478-F1 | 524-648 | 99.23 | 55.63 | View in AlphaFoldDB ↗ |