DPCfam | MC51690
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 243 ± 27 aa |
| Residues in low-complexity regions (%) | 2.9 |
| Residues in coiled-coil regions (%) | 10.79 |
| Predicted disordered residues (%) | 18.23 |
| Average transmembrane regions | 1.1 |
| Dominant Pfam architecture(s) | PF13927 |
| Sequences matching dominant architecture (%) | 26.23 |
| Average overlap percent | 13.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7QDW4 | 451-728 | 278 | VTPHRLVFNWTREYGASVGNSSINGPVGRNDTPKFVLLENGKLFIREVQRGDSGYYRCQATNVLGRHTVAIHLTLDYDFLIRVKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VK28-F1 | 727-969 | 97.92 | 78.45 | View in AlphaFoldDB ↗ |