DPCfam | MC5165
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 277 ± 29 aa |
| Residues in low-complexity regions (%) | 10.81 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 2.74 |
| Average transmembrane regions | 7.42 |
| Dominant Pfam architecture(s) | PF03956 |
| Sequences matching dominant architecture (%) | 80.77 |
| Average overlap percent | 66.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6VTK0 | 23-303 | 281 | KLFTPARVAKGLEQLVYLILGLIGFSLGALDNLAEKLFIAGYQAIIFFVLISVLSLAGLYLSGLRFGGTHADSLAQGPSDSKNHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GM73-F1 | 21-297 | 99.29 | 90.40 | View in AlphaFoldDB ↗ |