DPCfam | MC51543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Residues in low-complexity regions (%) | 6.73 |
| Residues in coiled-coil regions (%) | 24.55 |
| Predicted disordered residues (%) | 26.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10376 |
| Sequences matching dominant architecture (%) | 68.92 |
| Average overlap percent | 62.76 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067QLE1 | 286-373 | 88 | LNILKRQITVKEEEVKRLKLTLLYKKKHDVNELAIEIARWKEGCQEALRRLHQASTLQGYQLNMTQLLETFGIPPEAIGYNEDTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7ZD04-F1 | 113-199 | 97.75 | 86.50 | View in AlphaFoldDB ↗ |