DPCfam | MC51494
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00475 |
| Sequences matching dominant architecture (%) | 98.7 |
| Average overlap percent | 27.27 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2QYM2 | 1-73 | 73 | MRTSKISRKTKETDIELELNLDGGGKAEVNTPVNFLNHMLENLSKHSRFDLKINAKGDVEVDDHHTVEDIAIC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0W0J2-F1 | 2-76 | 100.00 | 98.49 | View in AlphaFoldDB ↗ |