DPCfam | MC51356
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08859 |
| Sequences matching dominant architecture (%) | 99.48 |
| Average overlap percent | 89.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3K369 | 10-112 | 103 | CLCGSGEYIVIACSGACDLGQVTDLVARELRDNKVRKMNCLAAVGAGINPTIESFKSANLLLLDGCPVDCGKKILEQAGIENFHY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HXD2-F1 | 13-113 | 92.92 | 97.76 | View in AlphaFoldDB ↗ |