DPCfam | MC51246
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 197 ± 26 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.99 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF05003 |
| Sequences matching dominant architecture (%) | 81.4 |
| Average overlap percent | 11.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151QN23 | 434-618 | 185 | MDKILQWLTPLATNTTKAHQGFGWVGEWANASNQFGEKTAKENNLIRLQTLYYAEKQKIDFYIIELLAKLHYLVTFVRYRHNSIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0VAZ1-F1 | 148-344 | 100.00 | 59.42 | View in AlphaFoldDB ↗ |