DPCfam | MC51242
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 127 ± 28 aa |
| Residues in low-complexity regions (%) | 26.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 45.55 |
| Average transmembrane regions | 0.36 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007C7CF32 | 7-109 | 103 | RRIKASRAVPVTALVAFSLAFAAACSNDRGTVTADCAAKQRDGSYRAVADSYCDNHRSSGGHGGGGFVWIYGGSHASNGTVTGGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F4S6-F1 | 129-257 | 99.14 | 69.09 | View in AlphaFoldDB ↗ |