DPCfam | MC51197
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 358 ± 37 aa |
| Residues in low-complexity regions (%) | 3.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.44 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF01734 |
| Sequences matching dominant architecture (%) | 0.44 |
| Average overlap percent | 32.74 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A9ET02 | 347-671 | 325 | LALVCNINSLSLHSYYRGRLAHAYLPEVAAAGSGEDPLHFRLADVRPDSGAALHLINCTLNTSSSRREKQRSRRGESLVLSPLYC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54CM2-F1 | 744-1121 | 98.82 | 76.26 | View in AlphaFoldDB ↗ |