DPCfam | MC50744
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 248 ± 31 aa |
| Residues in low-complexity regions (%) | 18.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 71.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L9SMV3 | 1-274 | 274 | MTATLNGTYNPAPDTPSPVYPDRLIRPLPKRTLRSRLSLDAADSILYPPAPPAPPAAQLFYGSCADHADVVNDSKVYVQQNGDVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GZZ8-F1 | 12-260 | 98.83 | 50.30 | View in AlphaFoldDB ↗ |