DPCfam | MC50531
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 240 ± 32 aa |
| Residues in low-complexity regions (%) | 3.54 |
| Residues in coiled-coil regions (%) | 0.45 |
| Predicted disordered residues (%) | 29.23 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00642 |
| Sequences matching dominant architecture (%) | 1.9 |
| Average overlap percent | 7.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9ELT1 | 226-481 | 256 | HLKSLKKDHDSEDVPEQVKNSTIALPMLVGPEEATSGIVFQDWIAQISGPMQDLSATSSVWWQGVMDLVQATYSKWLSANPLERL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4JGH9-F1 | 279-313 | 13.73 | 68.55 | View in AlphaFoldDB ↗ |