DPCfam | MC504418
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12755 |
| Sequences matching dominant architecture (%) | 1.25 |
| Average overlap percent | 63.95 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D3B5E8 | 18-103 | 86 | DDHSLRKEKIEACRTIAEQICSPSIRNNSDFPRFLSIAISLLLRAHGDKDLNVYSVAEESLNRTIKILIYTYHERILFELFRVLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z7F2-F1 | 1-50 | 52.69 | 82.76 | View in AlphaFoldDB ↗ |