DPCfam | MC504242
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 459 ± 57 aa |
| Residues in low-complexity regions (%) | 7.12 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 6.95 |
| Average transmembrane regions | 7.43 |
| Dominant Pfam architecture(s) | PF07819 |
| Sequences matching dominant architecture (%) | 0.79 |
| Average overlap percent | 3.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8ZR19 | 598-1006 | 409 | PKLWDSLLSYRVSCSSKAYTSDRLIFEPLIRQWIEDPFETKWHVNINNSDIDINMHNVAPFIPLEELHDKSLMLTVIVPPNYGLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1DWP9-F1 | 645-1110 | 99.78 | 83.56 | View in AlphaFoldDB ↗ |