DPCfam | MC504160
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 136 ± 7 aa |
| Residues in low-complexity regions (%) | 1.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09393 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 96.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L3NII4 | 3-139 | 137 | KGNEVITGDKGRIWVNTELWANLTSIEAKCSLETEDVRFVGDPNKYVKITGNNIEGTITIKKTDSRAQRLLAEGFRTLNMPDINI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54332-F1 | 6-139 | 97.78 | 74.48 | View in AlphaFoldDB ↗ |