DPCfam | MC503898
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.13 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF12242- PF12241 |
| Sequences matching dominant architecture (%) | 89.74 |
| Average overlap percent | 36.19 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A098G1G8 | 2-95 | 94 | MIVQPKIFGFICTTAHPLGCFKNVEEQVNYIKKEGQFTGIKNVLVIGASTGYGLASRIAAAFGSQAKTIGIIFEKPADEKRTASP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5QYR6-F1 | 1-103 | 99.03 | 96.80 | View in AlphaFoldDB ↗ |