DPCfam | MC503513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07726- PF17863 |
| Sequences matching dominant architecture (%) | 73.11 |
| Average overlap percent | 35.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A143XDR4 | 45-127 | 83 | MVSLSVGYPDYDSELAMVLGVRGKSRVEDIVSVFQGDTLRDIQNAVDQVHLKENVGDYIVRLVRATREHPELSCGGSPRASIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94474-F1 | 170-252 | 100.00 | 94.75 | View in AlphaFoldDB ↗ |