DPCfam | MC503313
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 396 ± 71 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 34.55 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF08839- PF16679 |
| Sequences matching dominant architecture (%) | 77.99 |
| Average overlap percent | 90.39 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B6ZTV0 | 60-317 | 258 | PTLSLPFSYKMLEGAFQAMDLVVSMMHNRSEMCTFSKLKAAVQNMTKKNFEEVTVGQIKTIVPESYIFRHENNMATFGKKLSGYQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1L8C7-F1 | 101-590 | 97.68 | 63.97 | View in AlphaFoldDB ↗ |