DPCfam | MC503205
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 211 ± 28 aa |
| Residues in low-complexity regions (%) | 1.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.04 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E381B5 | 684-906 | 223 | RRLHPELWFNEAGETNDGPVCRCSASDKQQGIRHSIYPGETVIPACDPLTNNADKLHHYWMTVTPHTNFMTENPSIIHFEGKDYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4EPC9-F1 | 460-742 | 99.58 | 77.23 | View in AlphaFoldDB ↗ |