DPCfam | MC503204
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1301 |
|---|---|
| Mean domain length (aa) | 142 ± 25 aa |
| Residues in low-complexity regions (%) | 15.63 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 23.7 |
| Average transmembrane regions | 0.95 |
| Dominant Pfam architecture(s) | PF11181 |
| Sequences matching dominant architecture (%) | 32.38 |
| Average overlap percent | 83.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K0PQ77 | 18-132 | 115 | LSTLSALFDDRGEAESAIKRLKEIGLPDDRIRFMPGDEAGDARRPEPGGWFAGLENWLFPDEDRASYAEGLRRGGYLVSVQVDDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94560-F1 | 2-115 | 94.03 | 64.45 | View in AlphaFoldDB ↗ |