DPCfam | MC503071
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Residues in low-complexity regions (%) | 2.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A194UZP2 | 3-79 | 77 | ALKPPIDSFAINLPTENISFLHRSYPDNQNVLLTLPAVDKSDGTHGVLHGIHHETARIACAILANCHWEGYFCATRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NFG2-F1 | 22-83 | 90.91 | 96.08 | View in AlphaFoldDB ↗ |