DPCfam | MC502935
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 631 |
|---|---|
| Mean domain length (aa) | 191 ± 28 aa |
| Residues in low-complexity regions (%) | 2.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.4 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF03281 |
| Sequences matching dominant architecture (%) | 94.6 |
| Average overlap percent | 77.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3AJE7 | 309-448 | 140 | LNIDILPTTKIADTVLFAEPCTKGYVDNLWCQSFYTTEMNKLRDLDDADFGFRQYCIRILKGICKDNPPLVKLSTRQLTTVVLHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TW90-F1 | 154-348 | 98.40 | 94.98 | View in AlphaFoldDB ↗ |