DPCfam | MC502827
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 254 ± 33 aa |
| Residues in low-complexity regions (%) | 5.42 |
| Residues in coiled-coil regions (%) | 0.58 |
| Predicted disordered residues (%) | 14.54 |
| Average transmembrane regions | 1.52 |
| Dominant Pfam architecture(s) | PF08637 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 77.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9H671 | 11-253 | 243 | IIQSIIDIGSTTIDFWGNWVVHPIRKLIGTIRHDEKSEIAIMSKNSLLADRASLERMVVDFVLDRPDLHQGIVADTTAIVNSVKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2E519-F1 | 338-591 | 99.59 | 81.89 | View in AlphaFoldDB ↗ |