DPCfam | MC502654
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 168 ± 12 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07488 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 54.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A4IP80 | 145-311 | 167 | PKNKLRMINHWDNMDGSIERGYAGQSVFFADGQFVKQKQRIKDYARLLASVGINAISINNVNVHQLETKLIAEEWLPEVAKVADI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q09LY5-F1 | 140-306 | 100.00 | 98.41 | View in AlphaFoldDB ↗ |