DPCfam | MC502440
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Residues in low-complexity regions (%) | 0.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08497 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q1FW67 | 124-208 | 85 | KEIFKGIPVVIGGIEASLRRFAHYDYYSDKIRKSILADSKADLLVYGMGESQILEIVKRVEHQGPDFDRSGIPGTCYLQSSPQGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DAI5-F1 | 137-227 | 96.81 | 96.19 | View in AlphaFoldDB ↗ |