DPCfam | MC502236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2911 |
|---|---|
| Mean domain length (aa) | 554 ± 66 aa |
| Residues in low-complexity regions (%) | 1.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.52 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01835 |
| Sequences matching dominant architecture (%) | 13.09 |
| Average overlap percent | 17.3 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4VRL8 | 82-604 | 523 | GETRDVQFEIEDLQGGEYQLRAEGLSGLTFENVTDLNFMKKSFSIFVQTDKAVYKPGDTVRFRVLVLDPNTKPFQIRGNMDVYIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q63041-F1 | 125-621 | 95.62 | 86.68 | View in AlphaFoldDB ↗ |