DPCfam | MC502144
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00544 |
| Sequences matching dominant architecture (%) | 2.0 |
| Average overlap percent | 23.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5KXW0 | 225-353 | 129 | GGSQSTFHHNMLAHNYSRSPRFQGARDDDYVVYNEFVNNVNYNWGKVNACYGGENNSPSNRYQGHQVNFVNNYWKPGPATIKGNS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8NQQ7-F1 | 191-282 | 89.66 | 97.34 | View in AlphaFoldDB ↗ |