DPCfam | MC502139
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Residues in low-complexity regions (%) | 12.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00183 |
| Sequences matching dominant architecture (%) | 89.32 |
| Average overlap percent | 29.34 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6HA52 | 2379-2446 | 67 | SITQLLFETSLLVSGFTIEEPSGFAERIHKLVSLGLNIDEDAETSEEKEADTVVAEAPGESAMEEVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P30946-F1 | 618-694 | 100.00 | 66.36 | View in AlphaFoldDB ↗ |