DPCfam | MC501949
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1161 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Residues in low-complexity regions (%) | 1.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02606 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3YP41 | 237-329 | 93 | HGRQVIALSGIGNPKPFLATLRERYEVVQEMTLEDHHVYKVRDLNRLRELLARWPGAVIVTTEKDAVKLTNRAKIPEEIRRSIYY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1GZI1-F1 | 238-315 | 94.05 | 94.25 | View in AlphaFoldDB ↗ |