DPCfam | MC50191
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Residues in low-complexity regions (%) | 4.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.19 |
| Average transmembrane regions | 2.8 |
| Dominant Pfam architecture(s) | PF04756 |
| Sequences matching dominant architecture (%) | 74.63 |
| Average overlap percent | 83.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4J3R7 | 27-166 | 140 | PFQRFFKPPVLHTPLSTIQWPNIIFSTCLLFVSFLVISGGVVFCYVNGMPMIGYHRDQSGQIVSSWIDPNGLSSQYLAEGIIASL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0J9XL27-F1 | 15-146 | 100.00 | 86.41 | View in AlphaFoldDB ↗ |