DPCfam | MC50090
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 288 ± 44 aa |
| Residues in low-complexity regions (%) | 13.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15344 |
| Sequences matching dominant architecture (%) | 96.3 |
| Average overlap percent | 77.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A2AJW5 | 18-388 | 370 | QVQHSKTTSGKRQSGSQGPHVSSQLRSSLLGISQPAAEKLMETVPTEGIQEQAALSSRYQAASGSKLFLDFHSMEIMKGADEDSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9NTX9-F1 | 75-345 | 98.26 | 61.39 | View in AlphaFoldDB ↗ |