DPCfam | MC500857
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 221 ± 23 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.59 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V1TR58 | 171-353 | 183 | LIRITVDSIGISKIERISPQAYKGECYSSRVYVVEQEQAVFKCKVQFKDGFSRLELASSSPLSPPAIWNTPDPPDLQLCRAYERK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PT05-F1 | 234-428 | 87.32 | 83.58 | View in AlphaFoldDB ↗ |