DPCfam | MC500765
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09848 |
| Sequences matching dominant architecture (%) | 99.45 |
| Average overlap percent | 30.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7T9P9 | 83-188 | 106 | DRPWAQRPETLHEVGSIYTIQGFDLNYAGVILGPSLGYDPSKDRLTVDLAQYQDKEAFKKRPDLADTTDAKAAIIMNAINILLKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ERH0-F1 | 515-610 | 96.88 | 89.98 | View in AlphaFoldDB ↗ |