DPCfam | MC500604
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 317 ± 30 aa |
| Residues in low-complexity regions (%) | 4.92 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 19.71 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF07693 |
| Sequences matching dominant architecture (%) | 16.67 |
| Average overlap percent | 19.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000372B1D4 | 724-1083 | 360 | RRGWSLLRVLRSMLTRTKARSKQDLLVDLARRDLTQIRFLQTLTTGWSGKLTLPLKIDLSRTRSTQVSQRPLTHPELVGQLQRFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57641-F1 | 112-173 | 19.15 | 83.93 | View in AlphaFoldDB ↗ |