DPCfam | MC500506
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03306 |
| Sequences matching dominant architecture (%) | 0.99 |
| Average overlap percent | 2.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00083935F3 | 8-175 | 168 | KALNPAYRKHKPLRKDVTNFIVQLQDCINAVKLSDDNGESEEHIKSHFTTFFNTTFYANNYINTKDRIDLAIYLEDKPTSDIGVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PC94-F1 | 12-170 | 98.14 | 89.31 | View in AlphaFoldDB ↗ |