DPCfam | MC500402
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Residues in low-complexity regions (%) | 3.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7MLC0 | 559-661 | 102 | LFDYQKLLEKADAITDDLDARYAAYAKADAWIVENAFAISVQCTAVANTVTRRVPFEGPYSIAGLGGNKFKLMRIQKDIVTSKDY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DQB2-F1 | 121-221 | 99.00 | 91.78 | View in AlphaFoldDB ↗ |